Page 1 of 2 12 Last
  • Jump to page:
    #1
  1. No Profile Picture
    Contributing User
    Devshed Newbie (0 - 499 posts)

    Join Date
    May 2012
    Posts
    63
    Rep Power
    3

    Request to check


    Hi all


    I have a big file which I am not able to attach here

    And, I have to fetch certain entries and arrange in 5 columns


    Code:
    Name Drug DAP ID disease approved or not

    In the attached file data is arranged with tab separated columns in this way:
    Quote:
    TTDS00001 Name

    Drug(s) DAPID Disease name Approved /(blank)


    and other data is also present which I dont want to fetch

    I want the output should be like this


    Quote:
    Name Drug DAP ID disease Approved or not

    Muscarinic Bethanechol DAP000263 Urinary retention Approved
    acetylcholine
    receptor
  2. #2
  3. No Profile Picture
    Contributing User
    Devshed Newbie (0 - 499 posts)

    Join Date
    May 2012
    Posts
    63
    Rep Power
    3

    Request to check


    Hi

    Here is sample for my this post:


    TTDS00001 Name Muscarinic acetylcholine receptor
    TTDS00001 Type of target Successful target
    TTDS00001 Synonyms (m)AChR
    TTDS00001 Synonyms MAChR
    TTDS00001 Disease Alzheimer's disease
    TTDS00001 Disease Bronchospasm (histamine induced)
    TTDS00001 Disease Glaucoma
    TTDS00001 Disease Motion sickness
    TTDS00001 Disease Obstructive airway disease
    TTDS00001 Disease Organophosphate poisoning
    TTDS00001 Disease Schizophrenia
    TTDS00001 Disease Urinary incontinence
    TTDS00001 Disease Xerostomia
    TTDS00001 BioChemical Class G-protein coupled receptor (rhodopsin family)
    TTDS00001 Pathway Calcium signaling pathway
    TTDS00001 Pathway Neuroactive ligand-receptor interaction
    TTDS00001 Pathway Regulation of actin cytoskeleton
    TTDS00001 Related US Patent 6,211,204
    TTDS00001 Related US Patent 6,323,194
    TTDS00001 Related US Patent 6,369,081
    TTDS00001 Related US Patent 6,376,675
    TTDS00001 Related US Patent 6,423,842
    TTDS00001 Related US Patent 6,451,797
    TTDS00001 Related US Patent 6,455,552
    TTDS00001 Related US Patent 6,458,812
    TTDS00001 Related US Patent 6,555,550
    TTDS00001 Related US Patent 6,602,891
    TTDS00001 Drug(s) Bethanechol DAP000263 Urinary retention Approved
    TTDS00001 Drug(s) Trospium DAP000342 Spasm Approved
    TTDS00001 Drug(s) Oxyphencyclimine DAP000835 Gastrointestinal disorders Approved
    TTDS00001 Drug(s) Tridihexethyl DAP000836 Acquired nystagmus Approved
    TTDS00001 Drug(s) Anisotropine Methylbromide DAP000837 Peptic ulcer disease Approved
    TTDS00001 Drug(s) Hyoscyamine DAP001108 Gastrointestinal disorders Approved
    TTDS00001 Drug(s) Methantheline DAP001109 Irritable bowel syndrome Approved
    TTDS00001 Drug(s) Procyclidine DAP001110 Parkinson's disease Approved
    TTDS00001 Drug(s) Cyclopentolate DAP001111 Pediatric eye examinations Approved
    TTDS00001 Drug(s) Ipratropium DAP001112 Obstructive lung diseases Approved
    TTDS00001 Drug(s) Pilocarpine DAP001113 Glaucoma Approved
    TTDS00001 Drug(s) Flavoxate DAP001114 Muscle Relaxant Approved
    TTDS00001 Drug(s) Mepenzolate DAP001115 Peptic ulcer disease Approved
    TTDS00001 Drug(s) Ispaghula DAP001486 Irritable bowel syndrome Approved
    TTDS00001 Drug(s) Mebeverine DAP001494 Irritable bowel syndrome Approved
    TTDS00001 Drug(s) Trihexyphenidyl HCl DAP001532 Parkinson's Disease Approved
    TTDS00001 Antagonist Trospium DAP000342
    TTDS00001 Antagonist Hyoscyamine DAP001108
    TTDS00001 Antagonist Methantheline DAP001109
    TTDS00001 Antagonist Procyclidine DAP001110
    TTDS00001 Antagonist Cyclopentolate DAP001111
    TTDS00001 Antagonist Ipratropium DAP001112
    TTDS00001 Antagonist Flavoxate DAP001114
    TTDS00001 Antagonist Mepenzolate DAP001115
    TTDS00001 Antagonist Ispaghula DAP001486
    TTDS00001 Antagonist Mebeverine DAP001494
    TTDS00001 Antagonist Trihexyphenidyl HCl DAP001532
    TTDS00001 Agonist Bethanechol DAP000263
    TTDS00001 Agonist Pilocarpine DAP001113
    TTDS00001 Binder Oxyphencyclimine DAP000835
    TTDS00001 Binder Tridihexethyl DAP000836
    TTDS00001 Binder Anisotropine Methylbromide DAP000837
    TTDS00001 Drug(s) Aclidinium bromide DCL000677 Chronic obstructive pulmonary disease Phase III
    TTDS00001 Drug(s) CHF 5407 DCL000750 Chronic obstructive pulmonary disease Phase I
    TTDS00001 Drug(s) GSK233705 DCL000823 Chronic obstructive pulmonary disease Phase II completed
    TTDS00001 Drug(s) NVA237 DCL000901 Chronic obstructive pulmonary disease Phase III
    TTDS00001 Drug(s) Org-23366 DCL000911 Schizophrenia No development reported
    TTDS00001 Drug(s) OrM3 DCL000913 Chronic obstructive pulmonary disease Phase IIb
    TTDS00001 Antagonist Aclidinium bromide DCL000677
    TTDS00001 Antagonist CHF 5407 DCL000750
    TTDS00001 Antagonist GSK233705 DCL000823
    TTDS00001 Antagonist NVA237 DCL000901
    TTDS00001 Antagonist Org-23366 DCL000911
    TTDS00001 Antagonist OrM3 DCL000913
    TTDS00001 Multitarget Org-23366 DCL000911
    TTDS00001 Antagonist Aprophen DNC000245
    TTDS00001 Antagonist Benactyzine DNC000293
    TTDS00001 Antagonist Hyoscine DNC000757
    TTDS00001 Antagonist Hyoscyamine sulfate DNC000758
    TTDS00001 Antagonist Ipratropium bromide DNC000806
    TTDS00001 Agonist Muscarine DNC000970
    TTDS00001 Agonist RS 86 DNC001236
    TTDS00001 Target Validation TTDS00001
    TTDS00002 UniProt ID P11229
    TTDS00002 Name Muscarinic acetylcholine receptor M1
    TTDS00002 Type of target Successful target
    TTDS00002 Synonyms M1 receptor
    TTDS00002 Disease Alzheimer's disease
    TTDS00002 Disease Bronchospasm (histamine induced)
    TTDS00002 Disease Cognitive deficits
    TTDS00002 Disease Schizophrenia
    TTDS00002 Function The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins.
    TTDS00002 Sequence MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDL WLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLP VTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLW ELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
    TTDS00002 BioChemical Class G-protein coupled receptor (rhodopsin family)
    TTDS00002 Pathway Calcium signaling pathway
    TTDS00002 Pathway Neuroactive ligand-receptor interaction
    TTDS00002 Pathway Regulation of actin cytoskeleton
    TTDS00002 Related US Patent 6,288,068
    TTDS00002 Related US Patent 6,294,554
    TTDS00002 Related US Patent 6,627,645
    TTDS00002 Drug(s) Pirenzepine DAP000492 Peptic ulcer disease Approved
    TTDS00002 Drug(s) Glycopyrrolate DAP001116 Anesthetic Approved
    TTDS00002 Drug(s) Clidinium DAP001117 Abdominal/stomach pain Approved
    TTDS00002 Drug(s) Dicyclomine DAP001118 Irritable bowel syndrome Approved
    TTDS00002 Drug(s) Ethopropazine DAP001119 Parkinson's disease Approved
    TTDS00002 Drug(s) Cycrimine DAP001120 Parkinson's disease Approved
    TTDS00002 Drug(s) Benztropine DAP001121 Parkinson's disease Approved
    TTDS00002 Drug(s) Trihexyphenidyl DAP001122 Parkinson's disease Approved
    TTDS00002 Drug(s) Propantheline DAP001123 Excessive sweating (hyperhidrosis) Approved
    TTDS00002 Drug(s) Oxyphenonium DAP001124 Spasm Approved
    TTDS00002 Drug(s) Biperiden DAP001125 Parkinson's disease Approved
    TTDS00002 Antagonist Pirenzepine DAP000492
    TTDS00002 Antagonist Glycopyrrolate DAP001116
    TTDS00002 Antagonist Clidinium DAP001117
    TTDS00002 Antagonist Dicyclomine DAP001118
    TTDS00002 Antagonist Ethopropazine DAP001119
    TTDS00002 Antagonist Benztropine DAP001121
    TTDS00002 Antagonist Trihexyphenidyl DAP001122
    TTDS00002 Antagonist Propantheline DAP001123
    TTDS00002 Antagonist Oxyphenonium DAP001124
    TTDS00002 Antagonist Biperiden DAP001125
    TTDS00002 Binder Cycrimine DAP001120
    TTDS00002 Drug(s) Talsaclidine isomer DCL000268 Alzheimer's disease Discontinued
    TTDS00002 Drug(s) Sabcomeline hydrochloride DCL000279 Cardiovascular diseases Phase IIa
    TTDS00002 Drug(s) Talsaclidine fumarate DCL000303 Alzheimer's disease Discontinued
    TTDS00002 Drug(s) Xanomeline tartrate DCL000328 Alzheimer's disease Phase II
    TTDS00002 Drug(s) GSK573719 DCL000381 Chronic Obstructive Pulmonary Disease (COPD) Phase II
    TTDS00002 Drug(s) GSK961081 DCL000397 Chronic Obstructive Pulmonary Disease (COPD) Phase II completed
    TTDS00002 Drug(s) GSK1034702 DCL000402 Schizophrenia, Dementia Phase I completed
    TTDS00002 Drug(s) Darotropium DCL000514 COPD Suspended in Phase II in GSK 2009 Report
    TTDS00002 Drug(s) Darotropium + 642444 DCL000515 COPD Phase III
    TTDS00002 Drug(s) Revatropate DCL000957 Chronic obstructive pulmonary disease Discontinued in Phase I
    TTDS00002 Antagonist Revatropate DCL000957
    TTDS00002 Agonist Talsaclidine isomer DCL000268
    TTDS00002 Agonist Sabcomeline hydrochloride DCL000279
    TTDS00002 Agonist Talsaclidine fumarate DCL000303
    TTDS00002 Agonist Xanomeline tartrate DCL000328
    TTDS00002 Agonist GSK573719 DCL000381
    TTDS00002 Agonist GSK961081 DCL000397
    TTDS00002 Agonist GSK1034702 DCL000402
    TTDS00002 Agonist Darotropium DCL000514
    TTDS00002 Agonist Darotropium + 642444 DCL000515
    TTDS00002 Multitarget GSK961081 DCL000397
    TTDS00002 Multitarget Revatropate DCL000957
    TTDS00002 Agonist 77-LH-28-1 DNC000099
    TTDS00002 Agonist AC-260584 DNC000137
    TTDS00002 Agonist AC-42 DNC000138
    TTDS00002 Agonist AF150(S) DNC000165
    TTDS00002 Agonist AF267B DNC000166
    TTDS00002 Agonist LY-593039 DNC000910
    TTDS00002 Agonist NGX-267 DNC001012
    TTDS00002 Agonist Sabcomeline DNC001264
    TTDS00002 Agonist WAY-132983 DNC001510
    TTDS00002 Inhibitor Arecoline DNC002508
    TTDS00002 Inhibitor Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003640
    TTDS00002 Inhibitor Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003654
    TTDS00002 Inhibitor Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003659
    TTDS00002 Inhibitor 3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one DNC004147
    TTDS00002 Inhibitor 2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime DNC004159
    TTDS00002 Inhibitor ISOCLOZAPINE DNC004166
    TTDS00002 Inhibitor SB-202026 DNC004272
    TTDS00002 Inhibitor HIMBACINE DNC004995
    TTDS00002 Inhibitor RR(17)PZ DNC005944
    TTDS00002 Inhibitor Bo(15)PZ DNC005945
    TTDS00002 Inhibitor DIFLUOROBENZTROPINE DNC005986
    TTDS00002 Inhibitor BI-1356 DNC007901
    TTDS00002 Inhibitor FM1-10 DNC008187
    TTDS00002 Inhibitor FM1-43 DNC008188
    TTDS00002 Inhibitor A-987306 DNC008996
    TTDS00002 Inhibitor GNF-PF-5618 DNC009476
    TTDS00002 Inhibitor CREMASTRINE DNC009504
    TTDS00002 Inhibitor 1,1-diphenyl-2-(3-tropanyl)ethanol DNC009866
    TTDS00002 Inhibitor R-dimethindene DNC009877
    TTDS00002 Inhibitor Tiotropium Bromide DNC009882
    TTDS00002 Inhibitor XANOMELINE DNC011170
    TTDS00002 Inhibitor 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one DNC011171
    TTDS00002 Inhibitor 1-Methyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea DNC011427
    TTDS00002 Inhibitor ISOLOXAPINE DNC011498
    TTDS00002 Inhibitor 1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione DNC011500
    TTDS00002 Inhibitor CARAMIPEN DNC011755
    TTDS00002 Inhibitor FLUMEZAPINE DNC011857
    TTDS00002 Inhibitor AMINOBENZTROPINE DNC011950
    TTDS00002 Inhibitor 2-(4-Diethylamino-but-2-ynyl)-isoindole-1,3-dione DNC012005
    TTDS00002 Inhibitor 3-Tetrazol-2-yl-1-aza-bicyclo[2.2.2]octane DNC012098
    TTDS00002 Inhibitor SULFOARECOLINE DNC012122
    TTDS00002 Inhibitor 6-Dimethylamino-2-methyl-hex-4-ynal oxime DNC012306
    TTDS00002 Inhibitor 7-Pyrrolidin-1-yl-hept-5-yn-2-one DNC012322
    TTDS00002 Inhibitor 7-Dimethylamino-3-methyl-hept-5-yn-2-one DNC012323
    TTDS00002 Inhibitor 7-Pyrrolidin-1-yl-hept-5-yn-2-one oxime DNC012330
    TTDS00002 Inhibitor 7-Dimethylamino-hept-5-yn-2-one DNC012350
    TTDS00002 Inhibitor 7-Dimethylamino-hept-5-yn-2-one oxime DNC012351
    TTDS00002 Inhibitor N-(4-Dimethylamino-but-2-ynyl)-N-methyl-acetamide DNC012363
    TTDS00002 Inhibitor ACECLIDINE DNC012502
    TTDS00002 Inhibitor N-methoxyquinuclidine-3-carboximidoyl fluoride DNC012588
    TTDS00002 Inhibitor BRL-55473 DNC012594
    TTDS00002 Inhibitor N-methoxyquinuclidine-3-carboximidoyl chloride DNC012616
    TTDS00002 Inhibitor 2,8-Dimethyl-1-oxa-8-aza-spiro[4.5]decan-3-one DNC012765
    TTDS00002 Inhibitor 3alpha-(bis-chloro-phenylmethoxy)tropane DNC013136
    TTDS00002 Inhibitor 3-(3-benzylamino)-piperidin-2-one DNC013219
    TTDS00002 Target Validation TTDS00002
    TTDS00003 UniProt ID P08172
    TTDS00003 Name Muscarinic acetylcholine receptor M2
    TTDS00003 Type of target Successful target
    TTDS00003 Synonyms M2 receptor
    TTDS00003 Disease Alzheimer's disease
    TTDS00003 Disease Analgesics
    TTDS00003 Disease Autoimmune cardiomyopathy
    TTDS00003 Disease Bronchoconstriction (cold air-induced)
    TTDS00003 Disease Chronic obstructive pulmonary disease, unspecified
    TTDS00003 Disease Hypothermia
    TTDS00003 Disease Neurogenic bladder
    TTDS00003 Disease Pain, unspecified
    TTDS00003 Disease Tremor, unspecified
    TTDS00003 Function The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins.
    TTDS00003 Sequence MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWL ALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVI IMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITW APYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
    TTDS00003 PDB Structure 1LUB
    TTDS00003 BioChemical Class G-protein coupled receptor (rhodopsin family)
    TTDS00003 Pathway Calcium signaling pathway
    TTDS00003 Pathway Neuroactive ligand-receptor interaction
    TTDS00003 Pathway Regulation of actin cytoskeleton
    TTDS00003 Related US Patent 6,288,068
    TTDS00003 Related US Patent 6,294,554
    TTDS00003 Related US Patent 6,498,168
    TTDS00003 Related US Patent 6,500,822
    TTDS00003 Related US Patent 6,627,644
    TTDS00003 Related US Patent 6,635,658
    TTDS00003 Related US Patent 6,645,958
    TTDS00003 Related US Patent 6,667,301
    TTDS00003 Drug(s) Scopolamine DAP000343 Nausea and Addiction Approved
    TTDS00003 Drug(s) Methylscopolamine DAP001126 Peptic ulcer disease Approved
    TTDS00003 Drug(s) Gallamine Triethiodide DAP001127 Stabilize muscle contractions Approved
    TTDS00003 Antagonist Scopolamine DAP000343
    TTDS00003 Antagonist Methylscopolamine DAP001126
    TTDS00003 Antagonist Gallamine Triethiodide DAP001127
    TTDS00003 Antagonist (R)-4-[2-[3-(4-methoxy-benzoylamino)-benzyl]-piperidin-1-ylmethyl]piperidine-1-carboxylic acid amide (Ro-320-6206) DNC000011
    TTDS00003 Antagonist AF-DX116 DNC000167
    TTDS00003 Agonist CMI-1145 DNC000455
    TTDS00003 Agonist CMI-936 DNC000456
    TTDS00003 Antagonist Otenzepad DNC001068
    TTDS00003 Agonist Oxotremorine DNC001081
    TTDS00003 Agonist PTAC DNC001161
    TTDS00003 Inhibitor Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003640
    TTDS00003 Inhibitor Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003654
    TTDS00003 Inhibitor Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003659
    TTDS00003 Inhibitor 3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one DNC004147
    TTDS00003 Inhibitor 2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime DNC004159
    TTDS00003 Inhibitor ISOCLOZAPINE DNC004166
    TTDS00003 Inhibitor N-DESMETHYLCLOZAPINE DNC004426
    TTDS00003 Inhibitor SCH-211803 DNC004557
    TTDS00003 Inhibitor METHACHOLINE DNC004591
    TTDS00003 Inhibitor HIMBACINE DNC004995
    TTDS00003 Inhibitor METHOCTRAMINE DNC005816
    TTDS00003 Inhibitor METHOCTRAMINE HYDROCHLORIDE DNC007831
    TTDS00003 Inhibitor FM1-10 DNC008187
    TTDS00003 Inhibitor FM1-43 DNC008188
    TTDS00003 Inhibitor A-987306 DNC008996
    TTDS00003 Inhibitor GNF-PF-5618 DNC009476
    TTDS00003 Inhibitor 1,1-diphenyl-2-(3-tropanyl)ethanol DNC009866
    TTDS00003 Inhibitor Tiotropium Bromide DNC009882
    TTDS00003 Inhibitor XANOMELINE DNC011170
    TTDS00003 Inhibitor 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one DNC011171
    TTDS00003 Inhibitor 1-Methyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea DNC011427
    TTDS00003 Inhibitor ISOLOXAPINE DNC011498
    TTDS00003 Inhibitor 1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione DNC011500
    TTDS00003 Inhibitor CARAMIPEN DNC011755
    TTDS00003 Inhibitor FLUMEZAPINE DNC011857
    TTDS00003 Inhibitor 2-(4-Diethylamino-but-2-ynyl)-isoindole-1,3-dione DNC012005
    TTDS00003 Inhibitor 3-Tetrazol-2-yl-1-aza-bicyclo[2.2.2]octane DNC012098
    TTDS00003 Inhibitor SULFOARECOLINE DNC012122
    TTDS00003 Inhibitor 6-Dimethylamino-2-methyl-hex-4-ynal oxime DNC012306
    TTDS00003 Inhibitor 7-Pyrrolidin-1-yl-hept-5-yn-2-one DNC012322
    TTDS00003 Inhibitor 7-Dimethylamino-3-methyl-hept-5-yn-2-one DNC012323
    TTDS00003 Inhibitor 7-Pyrrolidin-1-yl-hept-5-yn-2-one oxime DNC012330
    TTDS00003 Inhibitor 7-Dimethylamino-hept-5-yn-2-one DNC012350
    TTDS00003 Inhibitor 7-Dimethylamino-hept-5-yn-2-one oxime DNC012351
    TTDS00003 Inhibitor N-(4-Dimethylamino-but-2-ynyl)-N-methyl-acetamide DNC012363
    TTDS00003 Inhibitor ACECLIDINE DNC012502
    TTDS00003 Inhibitor N-methoxyquinuclidine-3-carboximidoyl fluoride DNC012588
    TTDS00003 Inhibitor BRL-55473 DNC012594
    TTDS00003 Inhibitor N-methoxyquinuclidine-3-carboximidoyl chloride DNC012616
    TTDS00003 Inhibitor 2,8-Dimethyl-1-oxa-8-aza-spiro[4.5]decan-3-one DNC012765
    TTDS00003 Inhibitor 3-(3-benzylamino)-piperidin-2-one DNC013219
    TTDS00003 Target Validation TTDS00003
    TTDS00004 UniProt ID P20309
    TTDS00004 Name Muscarinic acetylcholine receptor M3
  4. #3
  5. No Profile Picture
    Contributing User
    Devshed Novice (500 - 999 posts)

    Join Date
    Jun 2012
    Location
    Paris area, France
    Posts
    843
    Rep Power
    496
    You have to explain where we are supposed to pick up the data that you want to report.

    For the time being I do not understand your file.

    example:

    Code:
    TTDS00001 Name Muscarinic acetylcholine receptor
    TTDS00001 Type of target Successful target
    TTDS00001 Synonyms (m)AChR
    TTDS00001 Synonyms MAChR
    TTDS00001 Disease Alzheimer's disease
    TTDS00001 Disease Bronchospasm (histamine induced)
    TTDS00001 Disease Glaucoma
    Is this telling us that the drug TTDS00001 is named "Muscarinic acetylcholine receptor" and that it is curing several diseases such as Alzheimer's disease, Bronchospasm and glaucoma? And if such is the case, what output do you expect?

    If this is something different, pick up some small part of your input et show us the output that you want for this input.
  6. #4
  7. !~ /m$/
    Devshed Specialist (4000 - 4499 posts)

    Join Date
    May 2004
    Location
    Reno, NV
    Posts
    4,264
    Rep Power
    1810
    It's a duplicate post. Looks like he posted twice with the same thread title, a minute apart. Might want someone to combine the threads.
  8. #5
  9. Banned ;)
    Devshed Supreme Being (6500+ posts)

    Join Date
    Nov 2001
    Location
    Woodland Hills, Los Angeles County, California, USA
    Posts
    9,648
    Rep Power
    4248
    I think I get it. The TTDS # tells us all the data that is associated with a particular record. The OP needs to pick up the line with the Name of the drug (which has "Name "in the line), then there are other lines with the same TTDS # that have the word "Drug" which need to be parsed for the various fields, which need to be picked up also.

    Something like this ought to do it:
    Code:
    #!/usr/bin/perl -w
    
    use strict;
    
    if ($#ARGV < 1) {
        print "Usage: $0 input_file output_file\n";
        exit 0;
    }
    
    my $input_file  = $ARGV[0];
    my $output_file = $ARGV[1];
    
    my $prev_ttds_num = '';
    my @diseases = ();
    my $drug_name = '';
    
    open my $IFH, '<', $input_file or die "$!\n";
    open my $OFH, '>', $output_file or die "$!\n";
    
    while (my $line = <$IFH>) {
        chomp $line;
        next if $line eq '';
        my @array = split /\t/, $line;
    
        my $ttds_num = shift @array;
        my $rec_type  = shift @array;
    
        if ($ttds_num ne $prev_ttds_num) {
    	if ($prev_ttds_num ne '') {
    	    dump_data($OFH, $drug_name, \@diseases);
    	}
    	$prev_ttds_num = $ttds_num;
    	@diseases = ();
    	$drug_name = '';
        }
    
        if ($rec_type eq 'Name') {
    	$drug_name = shift @array;
        }
        elsif ($rec_type eq 'Drug(s)') {
    	my $part_record = join("\t", @array);
    	push @diseases, $part_record;
        }
    }
    
    dump_data($OFH, $drug_name, \@diseases);
    close $OFH;
    close $IFH;
    
    print "Done\n";
    exit 0;
    
    ######################################################################
    #                                                                    #
    #                    S U B R O U T I N E S                           #
    #                                                                    #
    ######################################################################
    
    ## 
    # @brief Routine to dump out multiple records
    # @param FH - A file handle to write data out
    # @param drug_name - The name of the drug
    # @param disease_ref - An array references to list of disease data
    # @return undef
    #
    sub dump_data {
        my ($FH, $drug_name, $disease_ref) = @_;
        return if ($drug_name eq '');
        
        foreach my $disease (@{ $disease_ref }) {
    	print ${FH} "$drug_name\t$disease\n";
        }
    
        return;
    }
    Running it like this:
    Code:
    mb@hammerfall:~/perl$ ./parse_medicine.pl data.txt output.txt
    mb@hammerfall:~/perl$ cat output.txt
    
    Muscarinic acetylcholine receptor       Bethanechol     DAP000263       Urinary retention       Approved
    Muscarinic acetylcholine receptor       Trospium        DAP000342       Spasm   Approved
    Muscarinic acetylcholine receptor       Oxyphencyclimine        DAP000835       Gastrointestinal disorders      Approved
    Muscarinic acetylcholine receptor       Tridihexethyl   DAP000836       Acquired nystagmus      Approved
    Muscarinic acetylcholine receptor       Anisotropine Methylbromide      DAP000837       Peptic ulcer disease    Approved
    Muscarinic acetylcholine receptor       Hyoscyamine     DAP001108       Gastrointestinal disorders      Approved
    ....
    Is that what you're looking for?
    Up the Irons
    What Would Jimi Do? Smash amps. Burn guitar. Take the groupies home.
    "Death Before Dishonour, my Friends!!" - Bruce D ickinson, Iron Maiden Aug 20, 2005 @ OzzFest
    Down with Sharon Osbourne

    "I wouldn't hire a butcher to fix my car. I also wouldn't hire a marketing firm to build my website." - Nilpo
  10. #6
  11. No Profile Picture
    Contributing User
    Devshed Newbie (0 - 499 posts)

    Join Date
    May 2012
    Posts
    63
    Rep Power
    3

    Request to check


    Hi all,

    Thankyou for your reply. It was really halpful tounderstand

    But, I am novice and still facing soem issue like

    I have named perl fille name as programmTTD.perl and then changed it to prgrammTTD.pl

    I have put input file name as TTDtargets.txt and output file as TTDtargets2.txt

    then,I tried to run in different ways I gott following errors. Kindly guide me.

    I tried to run programm in differnet ways I m receivign folowing errors

    [QUOTE]bash-3.2$ perl programmTTD.perl
    Usage: programmTTD.perl TTD targets TTD targets2
    bash-3.2$ perl programmTTD.perl
    Bareword found where operator expected at programmTTD.perl line 10, near "$TTD targets"
    (Missing operator before targets?)
    "my" variable $TTD masks earlier declaration in same scope at programmTTD.perl line 11.
    Bareword found where operator expected at programmTTD.perl line 11, near "$TTD targets2"
    (Missing operator before targets2?)
    syntax error at programmTTD.perl line 10, near "$TTD targets "
    syntax error at programmTTD.perl line 11, near "$TTD targets2 "
    Global symbol "$input_file" requires explicit package name at programmTTD.perl line 17.
    Global symbol "$output_file" requires explicit package name at programmTTD.perl line 18.
    Execution of programmTTD.perl aborted due to compilation errors.
    bash-3.2$ ./programmTTD.pl TTD targets.txt output.txt
    bash: ./programmTTD.pl: No such file or directory
    bash-3.2$ ./programmTTD.perl TTD targets.txt output.txt
    bash: ./programmTTD.perl: Permission denied
    bash-3.2$ ./programmTTD.pl TTD targets.txt output.txt
    bash: ./programmTTD.pl: Permission denied
    bash-3.2$ ~/perl$ ./parse_medicine.pl data.txt output.txt
    bash: /home/mgrover/perl$: No such file or directory
    bash-3.2$
  12. #7
  13. No Profile Picture
    Contributing User
    Devshed Newbie (0 - 499 posts)

    Join Date
    May 2012
    Posts
    63
    Rep Power
    3

    Request to check


    I m using linux system with perl installed. Kindly check it
  14. #8
  15. No Profile Picture
    Contributing User
    Devshed Novice (500 - 999 posts)

    Join Date
    Jun 2012
    Location
    Paris area, France
    Posts
    843
    Rep Power
    496
    Please provide your code, so that we can tell you where you have these mistakes.
  16. #9
  17. No Profile Picture
    Contributing User
    Devshed Novice (500 - 999 posts)

    Join Date
    Jun 2012
    Location
    Paris area, France
    Posts
    843
    Rep Power
    496
    Originally Posted by keath
    It's a duplicate post. Looks like he posted twice with the same thread title, a minute apart. Might want someone to combine the threads.
    It does not seem so to me. The description of the data is different.
  18. #10
  19. !~ /m$/
    Devshed Specialist (4000 - 4499 posts)

    Join Date
    May 2004
    Location
    Reno, NV
    Posts
    4,264
    Rep Power
    1810
    Well, I have some other unhelpful advice, so I'll finally speak my mind.

    There are now three similarly named threads. There hasn't been any feedback given from the OP to given code, just a new thread with different requirements.

    This is the part that initially caught my eye:

    I have a big file which I am not able to attach here

    And, I have to fetch certain entries and arrange in 5 columns
    The data is clearly relational in nature. A lot of the information is unlikely to change (U.S. patents, for example). There is probably some new element being tested (the sequence perhaps?) and the rest of the data should be on file somewhere.

    So a programming challenge has been presented: Can the data shown be rearranged? Yeah, sure can.

    But I am wondering how the data came to be in this form. Are we going to rebuild a temporary related model in memory each time and then just throw it away (large file, remember?), or is the data already in a database, and we just aren't using it properly?

    Perhaps a better SQL query could have done the job.
  20. #11
  21. Banned ;)
    Devshed Supreme Being (6500+ posts)

    Join Date
    Nov 2001
    Location
    Woodland Hills, Los Angeles County, California, USA
    Posts
    9,648
    Rep Power
    4248
    Originally Posted by manigrover
    Hi all,

    Thankyou for your reply. It was really halpful tounderstand

    But, I am novice and still facing soem issue like

    I have named perl fille name as programmTTD.perl and then changed it to prgrammTTD.pl

    I have put input file name as TTDtargets.txt and output file as TTDtargets2.txt

    then,I tried to run in different ways I gott following errors. Kindly guide me.

    I tried to run programm in differnet ways I m receivign folowing errors
    The program was written to run if you'd precisely cut and paste it in, without changing anything on it. Here's how you run it (asuming you named the program name as programmTTD.pl and the input file is named TTDtargets.txt):
    Code:
    chmod 755 programmTTD.pl
    ./programTTD.pl TTDtargets.txt TTDtargets2.txt
    alternatively, you can run it as:
    Code:
    perl programTTD.pl TTDtargets.txt TTDtargets2.txt
    After you do this, the output should be stored in TTDtargets2.txt

    Do NOT change anything in the code above (just cut/paste it into your editor). You DO NOT have to rename $input_file or $output file to "TTD Targets" or "TTD Targets2" in the code, like you appear to have done.
    Last edited by Scorpions4ever; July 22nd, 2012 at 02:35 PM.
    Up the Irons
    What Would Jimi Do? Smash amps. Burn guitar. Take the groupies home.
    "Death Before Dishonour, my Friends!!" - Bruce D ickinson, Iron Maiden Aug 20, 2005 @ OzzFest
    Down with Sharon Osbourne

    "I wouldn't hire a butcher to fix my car. I also wouldn't hire a marketing firm to build my website." - Nilpo
  22. #12
  23. 'fie' on me, allege-dly
    Devshed Supreme Being (6500+ posts)

    Join Date
    Mar 2003
    Location
    in da kitchen ...
    Posts
    12,894
    Rep Power
    6444
    $sql++;
    --Ax
    without exception, there is no rule ...
    Handmade Irish Jewellery
    Targeted Advertising Cookie Optout (TACO) extension for Firefox
    The great thing about Object Oriented code is that it can make small, simple problems look like large, complex ones


    09 F9 11 02
    9D 74 E3 5B
    D8 41 56 C5
    63 56 88 C0
    Some people, when confronted with a problem, think "I know, I'll use regular expressions." Now they have two problems.
    -- Jamie Zawinski
    Detavil - the devil is in the detail, allegedly, and I use the term advisedly, allegedly ... oh, no, wait I did ...
    BIT COINS ANYONE
  24. #13
  25. No Profile Picture
    Contributing User
    Devshed Newbie (0 - 499 posts)

    Join Date
    May 2012
    Posts
    63
    Rep Power
    3
    Hi

    I checked this issue and run it again but this time it showing soem error like this


    bash-3.2$ perl programTTD.pl TTDtargets.txt TTDtargets2.txt
    Can't open perl script "programTTD.pl": No such file or directory
    bash-3.2$ perl programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    bash-3.2$ perl programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    bash-3.2$ perl programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    bash-3.2$ chmod 755 programmTTD.pl
    bash-3.2$ ./programTTD.pl TTDtargets.txt TTDtargets2.txt
    bash: ./programTTD.pl: No such file or directory
    bash-3.2$ ./programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    Even u can see below file is there with the same name


    programmTTD.perl~
    programmTTD.pl
    protein.q.gz
    run.pl
    run.pl~
    sara's data non duplicates.ods
    Sara's text data
    second_file.txt
    seq_gene.q.gz
    Superfile100*~
    test.pl~
    TTD2~
    TTD targets
    TTD Targets
    TTD Targets~
    Uniprot2
    Uniprot2~
    Uniprot Conversion for TTDs
    Unix file coommands.odt
    venn.doc
    venn.odt
    bash-3.2$ ./programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    bash-3.2$
    Can u please guide why its showing this error?
  26. #14
  27. No Profile Picture
    Contributing User
    Devshed Novice (500 - 999 posts)

    Join Date
    Jun 2012
    Location
    Paris area, France
    Posts
    843
    Rep Power
    496
    You are trying to run the program "programTTD.pl" and the file in your directory has a double m: "programmTTD.pl" .
  28. #15
  29. Banned ;)
    Devshed Supreme Being (6500+ posts)

    Join Date
    Nov 2001
    Location
    Woodland Hills, Los Angeles County, California, USA
    Posts
    9,648
    Rep Power
    4248
    Originally Posted by manigrover
    Hi

    I checked this issue and run it again but this time it showing soem error like this

    bash-3.2$ perl programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    bash-3.2$ ./programmTTD.pl TTDtargets.txt TTDtargets2.txt
    No such file or directory
    The above two ways are the correct way to run the program. The "No such file or directory" is coming from inside the program. That gives you a very good clue as to where the problem is. It must mean that the input file TTDtargets.txt does not exist.

    Sure enough, in the listing of the files in your directory, you have:
    Originally Posted by manigrover
    programmTTD.perl~
    programmTTD.pl
    protein.q.gz
    run.pl
    run.pl~
    sara's data non duplicates.ods
    Sara's text data
    second_file.txt
    seq_gene.q.gz
    Superfile100*~
    test.pl~
    TTD2~
    TTD targets
    TTD Targets
    TTD Targets~
    As you can see from your listing, you've named your input file as "TTD Targets" and "TTD targets". Note that you have a space in the middle of these filenames. However, you are running the program and telling it that the file name is "TTDtargets.txt". This has no space and ".txt" at the end. The poor program is correctly telling you that the filename you've told it does not exist.

    Please rename your input file correctly to "TTDtargets.txt". Alternatively, please ask one of your university's CS students to give you a hand with this. The other option is to type in the filename correctly:
    Code:
    bash-3.2$ perl programmTTD.pl "TTD targets"  TTDtargets2.txt
    or
    bash-3.2$ ./programmTTD.pl "TTD targets" TTDtargets2.txt
    Up the Irons
    What Would Jimi Do? Smash amps. Burn guitar. Take the groupies home.
    "Death Before Dishonour, my Friends!!" - Bruce D ickinson, Iron Maiden Aug 20, 2005 @ OzzFest
    Down with Sharon Osbourne

    "I wouldn't hire a butcher to fix my car. I also wouldn't hire a marketing firm to build my website." - Nilpo
Page 1 of 2 12 Last
  • Jump to page:

IMN logo majestic logo threadwatch logo seochat tools logo