The Shed is going Social! Join us on FaceBook and Twitter and chime in on the conversation.
|
 |
|
Dev Shed Forums
> Programming Languages
> Python Programming
|
Fetch specific entries
Discuss Fetch specific entries in the Python Programming forum on Dev Shed. Fetch specific entries Python Programming forum discussing coding techniques, tips and tricks, and Zope related information. Python was designed from the ground up to be a completely object-oriented programming language.
|
|
 |
|
|
|
|

Dev Shed Forums Sponsor:
|
|
|

December 11th, 2012, 12:37 AM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
|
Fetch specific entries
Hi all
My input file is
PHP Code:
TTDS00002 UniProt ID P11229
TTDS00001 Name Muscarinic acetylcholine receptor
TTDS00001 Type of target Successful target
TTDS00001 Synonyms (m)AChR
TTDS00001 Synonyms MAChR
TTDS00001 Disease Alzheimer's disease
TTDS00001 Disease Bronchospasm (histamine induced)
TTDS00001 Disease Glaucoma
TTDS00001 Disease Motion sickness
TTDS00001 Disease Obstructive airway disease
TTDS00001 Disease Organophosphate poisoning
TTDS00001 Disease Schizophrenia
TTDS00001 Disease Urinary incontinence
TTDS00001 Disease Xerostomia
TTDS00001 BioChemical Class G-protein coupled receptor (rhodopsin family)
TTDS00001 Pathway Calcium signaling pathway
TTDS00001 Pathway Neuroactive ligand-receptor interaction
TTDS00001 Pathway Regulation of actin cytoskeleton
TTDS00001 Related US Patent 6,211,204
TTDS00001 Related US Patent 6,323,194
TTDS00001 Related US Patent 6,369,081
TTDS00001 Related US Patent 6,376,675
TTDS00001 Related US Patent 6,423,842
TTDS00001 Related US Patent 6,451,797
TTDS00001 Related US Patent 6,455,552
TTDS00001 Related US Patent 6,458,812
TTDS00001 Related US Patent 6,555,550
TTDS00001 Related US Patent 6,602,891
TTDS00001 Drug(s) Bethanechol DAP000263 Urinary retention Approved
TTDS00001 Drug(s) Trospium DAP000342 Spasm Approved
TTDS00001 Drug(s) Oxyphencyclimine DAP000835 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Tridihexethyl DAP000836 Acquired nystagmus Approved
TTDS00001 Drug(s) Anisotropine Methylbromide DAP000837 Peptic ulcer disease Approved
TTDS00001 Drug(s) Hyoscyamine DAP001108 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Methantheline DAP001109 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Procyclidine DAP001110 Parkinson's disease Approved
TTDS00001 Drug(s) Cyclopentolate DAP001111 Pediatric eye examinations Approved
TTDS00001 Drug(s) Ipratropium DAP001112 Obstructive lung diseases Approved
TTDS00001 Drug(s) Pilocarpine DAP001113 Glaucoma Approved
TTDS00001 Drug(s) Flavoxate DAP001114 Muscle Relaxant Approved
TTDS00001 Drug(s) Mepenzolate DAP001115 Peptic ulcer disease Approved
TTDS00001 Drug(s) Ispaghula DAP001486 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Mebeverine DAP001494 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Trihexyphenidyl HCl DAP001532 Parkinson's Disease Approved
TTDS00001 Antagonist Trospium DAP000342
TTDS00001 Antagonist Hyoscyamine DAP001108
TTDS00001 Antagonist Methantheline DAP001109
TTDS00001 Antagonist Procyclidine DAP001110
TTDS00001 Antagonist Cyclopentolate DAP001111
TTDS00001 Antagonist Ipratropium DAP001112
TTDS00001 Antagonist Flavoxate DAP001114
TTDS00001 Antagonist Mepenzolate DAP001115
TTDS00001 Antagonist Ispaghula DAP001486
TTDS00001 Antagonist Mebeverine DAP001494
TTDS00001 Antagonist Trihexyphenidyl HCl DAP001532
TTDS00001 Agonist Bethanechol DAP000263
TTDS00001 Agonist Pilocarpine DAP001113
TTDS00001 Binder Oxyphencyclimine DAP000835
TTDS00001 Binder Tridihexethyl DAP000836
TTDS00001 Binder Anisotropine Methylbromide DAP000837
TTDS00001 Drug(s) Aclidinium bromide DCL000677 Chronic obstructive pulmonary disease Phase III
TTDS00001 Drug(s) CHF 5407 DCL000750 Chronic obstructive pulmonary disease Phase I
TTDS00001 Drug(s) GSK233705 DCL000823 Chronic obstructive pulmonary disease Phase II completed
TTDS00001 Drug(s) NVA237 DCL000901 Chronic obstructive pulmonary disease Phase III
TTDS00001 Drug(s) Org-23366 DCL000911 Schizophrenia No development reported
TTDS00001 Drug(s) OrM3 DCL000913 Chronic obstructive pulmonary disease Phase IIb
TTDS00001 Antagonist Aclidinium bromide DCL000677
TTDS00001 Antagonist CHF 5407 DCL000750
TTDS00001 Antagonist GSK233705 DCL000823
TTDS00001 Antagonist NVA237 DCL000901
TTDS00001 Antagonist Org-23366 DCL000911
TTDS00001 Antagonist OrM3 DCL000913
TTDS00001 Multitarget Org-23366 DCL000911
TTDS00001 Antagonist Aprophen DNC000245
TTDS00001 Antagonist Benactyzine DNC000293
TTDS00001 Antagonist Hyoscine DNC000757
TTDS00001 Antagonist Hyoscyamine sulfate DNC000758
TTDS00001 Antagonist Ipratropium bromide DNC000806
TTDS00001 Agonist Muscarine DNC000970
TTDS00001 Agonist RS 86 DNC001236
TTDS00001 Target Validation TTDS00001
TTDS00002 UniProt ID P11229
TTDS00002 Name Muscarinic acetylcholine receptor M1
TTDS00002 Type of target Successful target
TTDS00002 Synonyms M1 receptor
TTDS00002 Disease Alzheimer's disease
TTDS00002 Disease Bronchospasm (histamine induced)
TTDS00002 Disease Cognitive deficits
TTDS00002 Disease Schizophrenia
TTDS00002 Function The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins.
TTDS00002 Sequence MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDL WLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLP VTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLW ELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
TTDS00002 BioChemical Class G-protein coupled receptor (rhodopsin family)
TTDS00002 Pathway Calcium signaling pathway
TTDS00002 Pathway Neuroactive ligand-receptor interaction
TTDS00002 Pathway Regulation of actin cytoskeleton
TTDS00002 Related US Patent 6,288,068
TTDS00002 Related US Patent 6,294,554
TTDS00002 Related US Patent 6,627,645
TTDS00002 Drug(s) Pirenzepine DAP000492 Peptic ulcer disease Approved
TTDS00002 Drug(s) Glycopyrrolate DAP001116 Anesthetic Approved
TTDS00002 Drug(s) Clidinium DAP001117 Abdominal/stomach pain Approved
TTDS00002 Drug(s) Dicyclomine DAP001118 Irritable bowel syndrome Approved
TTDS00002 Drug(s) Ethopropazine DAP001119 Parkinson's disease Approved
TTDS00002 Drug(s) Cycrimine DAP001120 Parkinson's disease Approved
TTDS00002 Drug(s) Benztropine DAP001121 Parkinson's disease Approved
TTDS00002 Drug(s) Trihexyphenidyl DAP001122 Parkinson's disease Approved
TTDS00002 Drug(s) Propantheline DAP001123 Excessive sweating (hyperhidrosis) Approved
TTDS00002 Drug(s) Oxyphenonium DAP001124 Spasm Approved
TTDS00002 Drug(s) Biperiden DAP001125 Parkinson's disease Approved
TTDS00002 Antagonist Pirenzepine DAP000492
TTDS00002 Antagonist Glycopyrrolate DAP001116
TTDS00002 Antagonist Clidinium DAP001117
TTDS00002 Antagonist Dicyclomine DAP001118
TTDS00002 Antagonist Ethopropazine DAP001119
TTDS00002 Antagonist Benztropine DAP001121
TTDS00002 Antagonist Trihexyphenidyl DAP001122
TTDS00002 Antagonist Propantheline DAP001123
TTDS00002 Antagonist Oxyphenonium DAP001124
TTDS00002 Antagonist Biperiden DAP001125
TTDS00002 Binder Cycrimine DAP001120
TTDS00002 Drug(s) Talsaclidine isomer DCL000268 Alzheimer's disease Discontinued
TTDS00002 Drug(s) Sabcomeline hydrochloride DCL000279 Cardiovascular diseases Phase IIa
TTDS00002 Drug(s) Talsaclidine fumarate DCL000303 Alzheimer's disease Discontinued
TTDS00002 Drug(s) Xanomeline tartrate DCL000328 Alzheimer's disease Phase II
TTDS00002 Drug(s) GSK573719 DCL000381 Chronic Obstructive Pulmonary Disease (COPD) Phase II
TTDS00002 Drug(s) GSK961081 DCL000397 Chronic Obstructive Pulmonary Disease (COPD) Phase II completed
TTDS00002 Drug(s) GSK1034702 DCL000402 Schizophrenia, Dementia Phase I completed
TTDS00002 Drug(s) Darotropium DCL000514 COPD Suspended in Phase II in GSK 2009 Report
TTDS00002 Drug(s) Darotropium + 642444 DCL000515 COPD Phase III
TTDS00002 Drug(s) Revatropate DCL000957 Chronic obstructive pulmonary disease Discontinued in Phase I
TTDS00002 Antagonist Revatropate DCL000957
TTDS00002 Agonist Talsaclidine isomer DCL000268
TTDS00002 Agonist Sabcomeline hydrochloride DCL000279
TTDS00002 Agonist Talsaclidine fumarate DCL000303
TTDS00002 Agonist Xanomeline tartrate DCL000328
TTDS00002 Agonist GSK573719 DCL000381
TTDS00002 Agonist GSK961081 DCL000397
TTDS00002 Agonist GSK1034702 DCL000402
TTDS00002 Agonist Darotropium DCL000514
TTDS00002 Agonist Darotropium + 642444 DCL000515
TTDS00002 Multitarget GSK961081 DCL000397
TTDS00002 Multitarget Revatropate DCL000957
TTDS00002 Agonist 77-LH-28-1 DNC000099
TTDS00002 Agonist AC-260584 DNC000137
TTDS00002 Agonist AC-42 DNC000138
TTDS00002 Agonist AF150(S) DNC000165
TTDS00002 Agonist AF267B DNC000166
TTDS00002 Agonist LY-593039 DNC000910
TTDS00002 Agonist NGX-267 DNC001012
TTDS00002 Agonist Sabcomeline DNC001264
TTDS00002 Agonist WAY-132983 DNC001510
TTDS00002 Inhibitor Arecoline DNC002508
TTDS00002 Inhibitor Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003640
TTDS00002 Inhibitor Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003654
TTDS00002 Inhibitor Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester DNC003659
TTDS00002 Inhibitor 3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one DNC004147
TTDS00002 Inhibitor 2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime DNC004159
My sample expected out put to fetch specific entries in 6 coumns as follows:Kindly guide
PHP Code:
P11229 Talsaclidine isomer DCL000268 Alzheimer's disease Discontinued agonist
P11229 Sabcomeline hydrochloride DCL000279 Cardiovascular diseases Phase IIa agonist
P11229 Talsaclidine fumarate DCL000303 Alzheimer's disease Discontinued agonist
P11229 Xanomeline tartrate DCL000328 Alzheimer's disease Phase II agonist
|

December 11th, 2012, 08:11 AM
|
 |
Contributing User
|
|
Join Date: May 2012
Location: 39N 104.28W
Posts: 97
Time spent in forums: 1 Day 15 h 26 m
Reputation Power: 2
|
|
|
From what little information you have provided, it looks like the first 2 fields of the input are consistent. I would read each line, split it on spaces, and collect the first 2 elements.
For the rest, you need to provide more information about how to parse the data. For instance, perhaps if the last word is ---? then the format is ***?
|

December 11th, 2012, 05:53 PM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
|
Thanks for reply.
The above input file is the part of my big file in which same sort of data is present as TTDS0002....TTDS0003 and so on
From the input I have to fetch the data in such a way that I will get Uniprot id, drug name, drug ID, disease name, approved/phase, agonist/inhibitor..
If disease name is not given like the last section of input which I think u described as inconsistent.. In this case, the disease coulmn should be blank as well as approve/phase will column information will also be blank only Uniprot id, drug name, drug ID,agonist/inhibitor will be included.
so as a sample output file I have included above is a small part of output expected.
|

December 11th, 2012, 07:55 PM
|
 |
Contributing User
|
|
|
|
|
I asked my son, a pharmacist, and his wife, a pharmacy student, to examine your puzzle. If they understand how the rows map from input to output I'll let you know.
__________________
[code] Code tags[/code] are essential for python code!
|

December 12th, 2012, 10:25 AM
|
 |
Contributing User
|
|
|
|
If this helps anyone's comprehension: Quote: | Originally Posted by Drew I read the original post and I am still not sure how exactly the guy is supposed to go about actually looking at all of this. I understand that the output is different than the input, meaning, the columns don't match up. *What seems to be unique in all of this is the drug name. all of the information for the output file can be taken from rows that contain the drug name. Furthermore, there is standardization in how each element is reported: the Uniprot ID is always the same, the drug ID always starts with D...*
Uniprot id, drug name, drug ID, disease name, approved/phase, agonist/inhibitor
Now coming from essentially a layperson's standpoint in how to code this, I am not sure. *But it seems that if there was some way to tell the program to fetch all of the lines that include the specific drug names, then you could tell the program what to look for, how to reorganize it, and how to output it.
|
|

December 12th, 2012, 10:39 AM
|
 |
Contributing User
|
|
Join Date: May 2012
Location: 39N 104.28W
Posts: 97
Time spent in forums: 1 Day 15 h 26 m
Reputation Power: 2
|
|
|
It doesn't help me. But maybe this.
@manigrover, forget programming for a minute. If you were a human being reading the input and hand-writing the output, how would you know what to write?
|

December 13th, 2012, 08:18 PM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
Thanks for reply
I m shortening my input first for example if this is the part of input file-
Quote:
TTDS00001 UniProt ID P11229
TTDS00001 Name Muscarinic acetylcholine receptor
TTDS00001 Type of target Successful target
TTDS00001 Synonyms (m)AChR
TTDS00001 Synonyms MAChR
TTDS00001 Disease Alzheimer's disease
TTDS00001 Disease Bronchospasm (histamine induced)
TTDS00001 Disease Glaucoma
TTDS00001 Disease Motion sickness
TTDS00001 Disease Obstructive airway disease
TTDS00001 Disease Organophosphate poisoning
TTDS00001 Disease Schizophrenia
TTDS00001 Disease Urinary incontinence
TTDS00001 Disease Xerostomia
TTDS00001 BioChemical Class G-protein coupled receptor (rhodopsin family)
TTDS00001 Pathway Calcium signaling pathway
TTDS00001 Pathway Neuroactive ligand-receptor interaction
TTDS00001 Pathway Regulation of actin cytoskeleton
TTDS00001 Related US Patent 6,211,204
TTDS00001 Related US Patent 6,323,194
TTDS00001 Related US Patent 6,369,081
TTDS00001 Related US Patent 6,376,675
TTDS00001 Related US Patent 6,423,842
TTDS00001 Related US Patent 6,451,797
TTDS00001 Related US Patent 6,455,552
TTDS00001 Related US Patent 6,458,812
TTDS00001 Related US Patent 6,555,550
TTDS00001 Related US Patent 6,602,891
TTDS00001 Drug(s) Bethanechol DAP000263 Urinary retention Approved
TTDS00001 Drug(s) Trospium DAP000342 Spasm Approved
TTDS00001 Drug(s) Oxyphencyclimine DAP000835 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Tridihexethyl DAP000836 Acquired nystagmus Approved
TTDS00001 Drug(s) Anisotropine Methylbromide DAP000837 Peptic ulcer disease Approved
TTDS00001 Drug(s) Hyoscyamine DAP001108 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Methantheline DAP001109 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Procyclidine DAP001110 Parkinson's disease Approved
TTDS00001 Drug(s) Cyclopentolate DAP001111 Pediatric eye examinations Approved
TTDS00001 Drug(s) Ipratropium DAP001112 Obstructive lung diseases Approved
TTDS00001 Drug(s) Pilocarpine DAP001113 Glaucoma Approved
TTDS00001 Drug(s) Flavoxate DAP001114 Muscle Relaxant Approved
TTDS00001 Drug(s) Mepenzolate DAP001115 Peptic ulcer disease Approved
TTDS00001 Drug(s) Ispaghula DAP001486 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Mebeverine DAP001494 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Trihexyphenidyl HCl DAP001532 Parkinson's Disease Approved
TTDS00001 Antagonist Trospium DAP000342
TTDS00001 Antagonist Hyoscyamine DAP001108
TTDS00001 Antagonist Methantheline DAP001109
TTDS00001 Antagonist Procyclidine DAP001110
TTDS00001 Antagonist Cyclopentolate DAP001111
TTDS00001 Antagonist Ipratropium DAP001112
TTDS00001 Antagonist Flavoxate DAP001114
TTDS00001 Antagonist Mepenzolate DAP001115
TTDS00001 Antagonist Ispaghula DAP001486
TTDS00001 Antagonist Mebeverine DAP001494
TTDS00001 Antagonist Trihexyphenidyl HCl DAP001532
TTDS00001 Agonist Bethanechol DAP000263
TTDS00001 Agonist Pilocarpine DAP001113
TTDS00001 Binder Oxyphencyclimine DAP000835
TTDS00001 Binder Tridihexethyl DAP000836
TTDS00001 Binder Anisotropine Methylbromide DAP000837
TTDS00001 Drug(s) Aclidinium bromide DCL000677 Chronic obstructive pulmonary disease Phase III
TTDS00001 Drug(s) CHF 5407 DCL000750 Chronic obstructive pulmonary disease Phase I
TTDS00001 Drug(s) GSK233705 DCL000823 Chronic obstructive pulmonary disease Phase II completed
TTDS00001 Drug(s) NVA237 DCL000901 Chronic obstructive pulmonary disease Phase III
TTDS00001 Drug(s) Org-23366 DCL000911 Schizophrenia No development reported
TTDS00001 Drug(s) OrM3 DCL000913 Chronic obstructive pulmonary disease Phase IIb
TTDS00001 Antagonist Aclidinium bromide DCL000677
TTDS00001 Antagonist CHF 5407 DCL000750
TTDS00001 Antagonist GSK233705 DCL000823
TTDS00001 Antagonist NVA237 DCL000901
TTDS00001 Antagonist Org-23366 DCL000911
TTDS00001 Antagonist OrM3 DCL000913
TTDS00001 Multitarget Org-23366 DCL000911
TTDS00001 Antagonist Aprophen DNC000245
TTDS00001 Antagonist Benactyzine DNC000293
TTDS00001 Antagonist Hyoscine DNC000757
TTDS00001 Antagonist Hyoscyamine sulfate DNC000758
TTDS00001 Antagonist Ipratropium bromide DNC000806
TTDS00001 Agonist Muscarine DNC000970
TTDS00001 Agonist RS 86 DNC001236
TTDS00001 Target Validation TTDS00001 |
Then part of expected sample output should contain columns like this
Quote: Uniprot id Drug Disease Drug Id Approved/Phase Action
P11229 Bethanechol DAP000263 Urinary retention Approved Agonist |
And,In the same way names of other drugs and diseases can come underneath it and if any information like disease name or approved/phase is missing for example drugs mentioned in the last that column will remain blank!
|

December 13th, 2012, 08:53 PM
|
 |
Contributing User
|
|
|
|
|
Why isn't
Pilocarpine DAP001113 Glaucoma Approved
in the output?
|

December 13th, 2012, 09:03 PM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
Thanks for reply
I just mentioned one drug. sorry but wasnt able to arrange all the drugs and diseases manually
yes
all these drugs and the one you mentioned, even others will also be in output.
Quote: TTDS00001 Drug(s) Bethanechol DAP000263 Urinary retention Approved
TTDS00001 Drug(s) Trospium DAP000342 Spasm Approved
TTDS00001 Drug(s) Oxyphencyclimine DAP000835 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Tridihexethyl DAP000836 Acquired nystagmus Approved
TTDS00001 Drug(s) Anisotropine Methylbromide DAP000837 Peptic ulcer disease Approved
TTDS00001 Drug(s) Hyoscyamine DAP001108 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Methantheline DAP001109 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Procyclidine DAP001110 Parkinson's disease Approved
TTDS00001 Drug(s) Cyclopentolate DAP001111 Pediatric eye examinations Approved
TTDS00001 Drug(s) Ipratropium DAP001112 Obstructive lung diseases Approved
TTDS00001 Drug(s) Pilocarpine DAP001113 Glaucoma Approved
TTDS00001 Drug(s) Flavoxate DAP001114 Muscle Relaxant Approved
TTDS00001 Drug(s) Mepenzolate DAP001115 Peptic ulcer disease Approved
TTDS00001 Drug(s) Ispaghula DAP001486 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Mebeverine DAP001494 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Trihexyphenidyl HCl DAP001532 Parkinson's Disease Approved |
Even those which ar ementioned in the last or in between without disease name in front of it but only Action(Antagonist, Inhibitor) will also come
like these
Quote: TTDS00001 Antagonist CHF 5407 DCL000750
TTDS00001 Antagonist GSK233705 DCL000823
TTDS00001 Antagonist NVA237 DCL000901
TTDS00001 Antagonist Org-23366 DCL000911
TTDS00001 Antagonist OrM3 DCL000913
TTDS00001 Multitarget Org-23366 DCL000911
TTDS00001 Antagonist Aprophen DNC000245
TTDS00001 Antagonist Benactyzine DNC000293
TTDS00001 Antagonist Hyoscine DNC000757
TTDS00001 Antagonist Hyoscyamine sulfate DNC000758
TTDS00001 Antagonist Ipratropium bromide DNC000806 |
|

December 16th, 2012, 07:01 AM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
|
If any one still have any question abut abo e ques plz let me know as some part of question already solved by perl script but I want to solve by python.
|

December 16th, 2012, 01:02 PM
|
 |
Contributing User
|
|
|
|
|
Answer rrashkin's crucial question, "If you were a human being reading the input and hand-writing the output, how would you know what to write?" There may be enough information between this thread and the other to solve the puzzle. However, you sadistically torment those whom you ask for help.
You have a solution. Will you pay for someone to rewrite it in python? I'll learn perl for pay.
Do we ignore lines that say "patent"? You haven't said.
What separates the columns? Do columns always end with "words" ending in digits?
|

December 16th, 2012, 07:38 PM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
Hi Thanks for message
I never thought to torment somebody.
I answered and tried to give expected output as much I understood the questions.
1)Do we ignore lines that say "patent"? You haven't said.
Yes Patent information is not needed.
2)
What separates the columns? Do columns always end with "words" ending in digits?
Columns are separated by tab separator
3)
Do columns always end with "words" ending in digits?
No only last few columns in input file ends with digits because these do not contain disease name and approval/phase in front of it.
Therefore, the sample expected out is like this
Quote:
Uniprot id Drug Drug Id Action Disease Approved/Phase
P11229 Bethanechol DAP000263 Agonist Urinary retention Approved
or even like this
P11229 Ipratropium bromide DNC000806 Antagonist
Int he second out put disease column and approval is blank because it is not mentioned in the input as well. |
|

December 16th, 2012, 07:49 PM
|
 |
Contributing User
|
|
|
|
There are no tabs in your original post!
Fields separated by tabs. A test to see if it's possible.
[edit]I managed to post tabs.[/edit]
[edit2]Indeed, tabs were the first separator I searched for.[/edit2]
Last edited by b49P23TIvg : December 16th, 2012 at 07:51 PM.
Reason: test conclusion
|

December 16th, 2012, 08:29 PM
|
|
Contributing User
|
|
Join Date: May 2012
Posts: 60
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
|
|
|
Ok
If output columns will be tab separated, that would be good.
Thanks
|
Developer Shed Advertisers and Affiliates
| Thread Tools |
Search this Thread |
|
|
|
| Display Modes |
Rate This Thread |
Linear Mode
|
|
Posting Rules
|
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts
HTML code is Off
|
|
|
|
|