Python Programming
 
Forums: » Register « |  User CP |  Games |  Calendar |  Members |  FAQs |  Sitemap |  Support | 
User Name:
Password:
Remember me

The Shed is going Social! Join us on FaceBook and Twitter and chime in on the conversation.

Go Back   Dev Shed ForumsProgramming LanguagesPython Programming

Reply
Add This Thread To:
  Del.icio.us   Digg   Google   Spurl   Blink   Furl   Simpy   Y! MyWeb 
Thread Tools Search this Thread Rate Thread Display Modes
 
Unread Dev Shed Forums Sponsor:
  #1  
Old December 11th, 2012, 12:37 AM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
Fetch specific entries

Hi all

My input file is

PHP Code:
 TTDS00002    UniProt ID    P11229
TTDS00001    Name    Muscarinic acetylcholine receptor 
TTDS00001    Type of target    Successful target 
TTDS00001    Synonyms    
(m)AChR 
TTDS00001    Synonyms    MAChR 
TTDS00001    Disease    Alzheimer
's disease 
TTDS00001    Disease    Bronchospasm (histamine induced) 
TTDS00001    Disease    Glaucoma 
TTDS00001    Disease    Motion sickness 
TTDS00001    Disease    Obstructive airway disease 
TTDS00001    Disease    Organophosphate poisoning 
TTDS00001    Disease    Schizophrenia 
TTDS00001    Disease    Urinary incontinence 
TTDS00001    Disease    Xerostomia 
TTDS00001    BioChemical Class    G-protein coupled receptor (rhodopsin family) 
TTDS00001    Pathway    Calcium signaling pathway 
TTDS00001    Pathway    Neuroactive ligand-receptor interaction 
TTDS00001    Pathway    Regulation of actin cytoskeleton 
TTDS00001    Related US Patent    6,211,204 
TTDS00001    Related US Patent    6,323,194 
TTDS00001    Related US Patent    6,369,081 
TTDS00001    Related US Patent    6,376,675 
TTDS00001    Related US Patent    6,423,842 
TTDS00001    Related US Patent    6,451,797 
TTDS00001    Related US Patent    6,455,552 
TTDS00001    Related US Patent    6,458,812 
TTDS00001    Related US Patent    6,555,550 
TTDS00001    Related US Patent    6,602,891 
TTDS00001    Drug(s)    Bethanechol    DAP000263    Urinary retention    Approved 
TTDS00001    Drug(s)    Trospium    DAP000342    Spasm    Approved 
TTDS00001    Drug(s)    Oxyphencyclimine    DAP000835    Gastrointestinal disorders    Approved 
TTDS00001    Drug(s)    Tridihexethyl    DAP000836    Acquired nystagmus    Approved 
TTDS00001    Drug(s)    Anisotropine Methylbromide    DAP000837    Peptic ulcer disease    Approved 
TTDS00001    Drug(s)    Hyoscyamine    DAP001108    Gastrointestinal disorders    Approved 
TTDS00001    Drug(s)    Methantheline    DAP001109    Irritable bowel syndrome    Approved 
TTDS00001    Drug(s)    Procyclidine    DAP001110    Parkinson'
s disease    Approved 
TTDS00001    Drug
(s)    Cyclopentolate    DAP001111    Pediatric eye examinations    Approved 
TTDS00001    Drug
(s)    Ipratropium    DAP001112    Obstructive lung diseases    Approved 
TTDS00001    Drug
(s)    Pilocarpine    DAP001113    Glaucoma    Approved 
TTDS00001    Drug
(s)    Flavoxate    DAP001114    Muscle Relaxant    Approved 
TTDS00001    Drug
(s)    Mepenzolate    DAP001115    Peptic ulcer disease    Approved 
TTDS00001    Drug
(s)    Ispaghula    DAP001486    Irritable bowel syndrome    Approved 
TTDS00001    Drug
(s)    Mebeverine    DAP001494    Irritable bowel syndrome    Approved 
TTDS00001    Drug
(s)    Trihexyphenidyl HCl    DAP001532    Parkinson's Disease    Approved 
TTDS00001    Antagonist    Trospium    DAP000342 
TTDS00001    Antagonist    Hyoscyamine    DAP001108 
TTDS00001    Antagonist    Methantheline    DAP001109 
TTDS00001    Antagonist    Procyclidine    DAP001110 
TTDS00001    Antagonist    Cyclopentolate    DAP001111 
TTDS00001    Antagonist    Ipratropium    DAP001112 
TTDS00001    Antagonist    Flavoxate    DAP001114 
TTDS00001    Antagonist    Mepenzolate    DAP001115 
TTDS00001    Antagonist    Ispaghula    DAP001486 
TTDS00001    Antagonist    Mebeverine    DAP001494 
TTDS00001    Antagonist    Trihexyphenidyl HCl    DAP001532 
TTDS00001    Agonist    Bethanechol    DAP000263 
TTDS00001    Agonist    Pilocarpine    DAP001113 
TTDS00001    Binder    Oxyphencyclimine    DAP000835 
TTDS00001    Binder    Tridihexethyl    DAP000836 
TTDS00001    Binder    Anisotropine Methylbromide    DAP000837 
TTDS00001    Drug(s)    Aclidinium bromide    DCL000677    Chronic obstructive pulmonary disease    Phase III 
TTDS00001    Drug(s)    CHF 5407    DCL000750    Chronic obstructive pulmonary disease    Phase I 
TTDS00001    Drug(s)    GSK233705    DCL000823    Chronic obstructive pulmonary disease    Phase II completed 
TTDS00001    Drug(s)    NVA237    DCL000901    Chronic obstructive pulmonary disease    Phase III 
TTDS00001    Drug(s)    Org-23366    DCL000911    Schizophrenia    No development reported 
TTDS00001    Drug(s)    OrM3    DCL000913    Chronic obstructive pulmonary disease    Phase IIb 
TTDS00001    Antagonist    Aclidinium bromide    DCL000677 
TTDS00001    Antagonist    CHF 5407    DCL000750 
TTDS00001    Antagonist    GSK233705    DCL000823 
TTDS00001    Antagonist    NVA237    DCL000901 
TTDS00001    Antagonist    Org-23366    DCL000911 
TTDS00001    Antagonist    OrM3    DCL000913 
TTDS00001    Multitarget    Org-23366    DCL000911 
TTDS00001    Antagonist    Aprophen    DNC000245 
TTDS00001    Antagonist    Benactyzine    DNC000293 
TTDS00001    Antagonist    Hyoscine    DNC000757 
TTDS00001    Antagonist    Hyoscyamine sulfate    DNC000758 
TTDS00001    Antagonist    Ipratropium bromide    DNC000806 
TTDS00001    Agonist    Muscarine    DNC000970 
TTDS00001    Agonist    RS 86    DNC001236 
TTDS00001    Target Validation    TTDS00001 
TTDS00002    UniProt ID    P11229 
TTDS00002    Name    Muscarinic acetylcholine receptor M1 
TTDS00002    Type of target    Successful target 
TTDS00002    Synonyms    M1 receptor 
TTDS00002    Disease    Alzheimer'
s disease 
TTDS00002    Disease    Bronchospasm 
(histamine induced
TTDS00002    Disease    Cognitive deficits 
TTDS00002    Disease    Schizophrenia 
TTDS00002    
Function    The muscarinic acetylcholine receptor mediates various cellular responsesincluding inhibition of adenylate cyclasebreakdown of phosphoinositides and modulation of potassium channels through the action of G proteins
TTDS00002    Sequence    MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDL     WLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLP     VTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV     VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLW     ELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC 
TTDS00002    BioChemical 
Class    G-protein coupled receptor (rhodopsin family
TTDS00002    Pathway    Calcium signaling pathway 
TTDS00002    Pathway    Neuroactive ligand
-receptor interaction 
TTDS00002    Pathway    Regulation of actin cytoskeleton 
TTDS00002    Related US Patent    6
,288,068 
TTDS00002    Related US Patent    6
,294,554 
TTDS00002    Related US Patent    6
,627,645 
TTDS00002    Drug
(s)    Pirenzepine    DAP000492    Peptic ulcer disease    Approved 
TTDS00002    Drug
(s)    Glycopyrrolate    DAP001116    Anesthetic    Approved 
TTDS00002    Drug
(s)    Clidinium    DAP001117    Abdominal/stomach pain    Approved 
TTDS00002    Drug
(s)    Dicyclomine    DAP001118    Irritable bowel syndrome    Approved 
TTDS00002    Drug
(s)    Ethopropazine    DAP001119    Parkinson's disease    Approved 
TTDS00002    Drug(s)    Cycrimine    DAP001120    Parkinson'
s disease    Approved 
TTDS00002    Drug
(s)    Benztropine    DAP001121    Parkinson's disease    Approved 
TTDS00002    Drug(s)    Trihexyphenidyl    DAP001122    Parkinson'
s disease    Approved 
TTDS00002    Drug
(s)    Propantheline    DAP001123    Excessive sweating (hyperhidrosis)    Approved 
TTDS00002    Drug
(s)    Oxyphenonium    DAP001124    Spasm    Approved 
TTDS00002    Drug
(s)    Biperiden    DAP001125    Parkinson's disease    Approved 
TTDS00002    Antagonist    Pirenzepine    DAP000492 
TTDS00002    Antagonist    Glycopyrrolate    DAP001116 
TTDS00002    Antagonist    Clidinium    DAP001117 
TTDS00002    Antagonist    Dicyclomine    DAP001118 
TTDS00002    Antagonist    Ethopropazine    DAP001119 
TTDS00002    Antagonist    Benztropine    DAP001121 
TTDS00002    Antagonist    Trihexyphenidyl    DAP001122 
TTDS00002    Antagonist    Propantheline    DAP001123 
TTDS00002    Antagonist    Oxyphenonium    DAP001124 
TTDS00002    Antagonist    Biperiden    DAP001125 
TTDS00002    Binder    Cycrimine    DAP001120 
TTDS00002    Drug(s)    Talsaclidine isomer    DCL000268    Alzheimer'
s disease    Discontinued 
TTDS00002    Drug
(s)    Sabcomeline hydrochloride    DCL000279    Cardiovascular diseases    Phase IIa 
TTDS00002    Drug
(s)    Talsaclidine fumarate    DCL000303    Alzheimer's disease    Discontinued 
TTDS00002    Drug(s)    Xanomeline tartrate    DCL000328    Alzheimer'
s disease    Phase II 
TTDS00002    Drug
(s)    GSK573719    DCL000381    Chronic Obstructive Pulmonary Disease (COPD)    Phase II 
TTDS00002    Drug
(s)    GSK961081    DCL000397    Chronic Obstructive Pulmonary Disease (COPD)    Phase II completed 
TTDS00002    Drug
(s)    GSK1034702    DCL000402    SchizophreniaDementia    Phase I completed 
TTDS00002    Drug
(s)    Darotropium    DCL000514    COPD    Suspended in Phase II in GSK 2009 Report 
TTDS00002    Drug
(s)    Darotropium 642444    DCL000515    COPD    Phase III 
TTDS00002    Drug
(s)    Revatropate    DCL000957    Chronic obstructive pulmonary disease    Discontinued in Phase I 
TTDS00002    Antagonist    Revatropate    DCL000957 
TTDS00002    Agonist    Talsaclidine isomer    DCL000268 
TTDS00002    Agonist    Sabcomeline hydrochloride    DCL000279 
TTDS00002    Agonist    Talsaclidine fumarate    DCL000303 
TTDS00002    Agonist    Xanomeline tartrate    DCL000328 
TTDS00002    Agonist    GSK573719    DCL000381 
TTDS00002    Agonist    GSK961081    DCL000397 
TTDS00002    Agonist    GSK1034702    DCL000402 
TTDS00002    Agonist    Darotropium    DCL000514 
TTDS00002    Agonist    Darotropium 
642444    DCL000515 
TTDS00002    Multitarget    GSK961081    DCL000397 
TTDS00002    Multitarget    Revatropate    DCL000957 
TTDS00002    Agonist    77
-LH-28-1    DNC000099 
TTDS00002    Agonist    AC
-260584    DNC000137 
TTDS00002    Agonist    AC
-42    DNC000138 
TTDS00002    Agonist    AF150
(S)    DNC000165 
TTDS00002    Agonist    AF267B    DNC000166 
TTDS00002    Agonist    LY
-593039    DNC000910 
TTDS00002    Agonist    NGX
-267    DNC001012 
TTDS00002    Agonist    Sabcomeline    DNC001264 
TTDS00002    Agonist    WAY
-132983    DNC001510 
TTDS00002    Inhibitor    Arecoline    DNC002508 
TTDS00002    Inhibitor    Acetic acid 8
-aza-bicyclo[3.2.1]oct-6-yl ester    DNC003640 
TTDS00002    Inhibitor    Benzoic acid 8
-aza-bicyclo[3.2.1]oct-6-yl ester    DNC003654 
TTDS00002    Inhibitor    Propionic acid 8
-aza-bicyclo[3.2.1]oct-6-yl ester    DNC003659 
TTDS00002    Inhibitor    3
-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one    DNC004147 
TTDS00002    Inhibitor    2
-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime    DNC004159 


My sample expected out put to fetch specific entries in 6 coumns as follows:Kindly guide

PHP Code:
 P11229    Talsaclidine isomer    DCL000268    Alzheimer's disease   Discontinued  agonist     
 P11229   Sabcomeline hydrochloride    DCL000279    Cardiovascular diseases    Phase IIa    agonist 
P11229    Talsaclidine fumarate    DCL000303    Alzheimer'
s disease        Discontinued   agonist
P11229    Xanomeline tartrate    DCL000328    Alzheimer
's disease    Phase II          agonist 

Reply With Quote
  #2  
Old December 11th, 2012, 08:11 AM
rrashkin's Avatar
rrashkin rrashkin is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Location: 39N 104.28W
Posts: 97 rrashkin User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 1 Day 15 h 26 m
Reputation Power: 2
From what little information you have provided, it looks like the first 2 fields of the input are consistent. I would read each line, split it on spaces, and collect the first 2 elements.

For the rest, you need to provide more information about how to parse the data. For instance, perhaps if the last word is ---? then the format is ***?

Reply With Quote
  #3  
Old December 11th, 2012, 05:53 PM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
Thanks for reply.

The above input file is the part of my big file in which same sort of data is present as TTDS0002....TTDS0003 and so on

From the input I have to fetch the data in such a way that I will get Uniprot id, drug name, drug ID, disease name, approved/phase, agonist/inhibitor..

If disease name is not given like the last section of input which I think u described as inconsistent.. In this case, the disease coulmn should be blank as well as approve/phase will column information will also be blank only Uniprot id, drug name, drug ID,agonist/inhibitor will be included.

so as a sample output file I have included above is a small part of output expected.

Reply With Quote
  #4  
Old December 11th, 2012, 07:55 PM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,460 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 4 Days 6 h 56 m 42 sec
Reputation Power: 403
I asked my son, a pharmacist, and his wife, a pharmacy student, to examine your puzzle. If they understand how the rows map from input to output I'll let you know.
__________________
[code]Code tags[/code] are essential for python code!

Reply With Quote
  #5  
Old December 12th, 2012, 10:25 AM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,460 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 4 Days 6 h 56 m 42 sec
Reputation Power: 403
If this helps anyone's comprehension:
Quote:
Originally Posted by Drew
I read the original post and I am still not sure how exactly the guy is supposed to go about actually looking at all of this. I understand that the output is different than the input, meaning, the columns don't match up. *What seems to be unique in all of this is the drug name. all of the information for the output file can be taken from rows that contain the drug name. Furthermore, there is standardization in how each element is reported: the Uniprot ID is always the same, the drug ID always starts with D...*
Uniprot id, drug name, drug ID, disease name, approved/phase, agonist/inhibitor

Now coming from essentially a layperson's standpoint in how to code this, I am not sure. *But it seems that if there was some way to tell the program to fetch all of the lines that include the specific drug names, then you could tell the program what to look for, how to reorganize it, and how to output it.

Reply With Quote
  #6  
Old December 12th, 2012, 10:39 AM
rrashkin's Avatar
rrashkin rrashkin is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Location: 39N 104.28W
Posts: 97 rrashkin User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 1 Day 15 h 26 m
Reputation Power: 2
It doesn't help me. But maybe this.
@manigrover, forget programming for a minute. If you were a human being reading the input and hand-writing the output, how would you know what to write?

Reply With Quote
  #7  
Old December 13th, 2012, 08:18 PM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
Thanks for reply

I m shortening my input first for example if this is the part of input file-

Quote:
TTDS00001 UniProt ID P11229
TTDS00001 Name Muscarinic acetylcholine receptor
TTDS00001 Type of target Successful target
TTDS00001 Synonyms (m)AChR
TTDS00001 Synonyms MAChR
TTDS00001 Disease Alzheimer's disease
TTDS00001 Disease Bronchospasm (histamine induced)
TTDS00001 Disease Glaucoma
TTDS00001 Disease Motion sickness
TTDS00001 Disease Obstructive airway disease
TTDS00001 Disease Organophosphate poisoning
TTDS00001 Disease Schizophrenia
TTDS00001 Disease Urinary incontinence
TTDS00001 Disease Xerostomia
TTDS00001 BioChemical Class G-protein coupled receptor (rhodopsin family)
TTDS00001 Pathway Calcium signaling pathway
TTDS00001 Pathway Neuroactive ligand-receptor interaction
TTDS00001 Pathway Regulation of actin cytoskeleton
TTDS00001 Related US Patent 6,211,204
TTDS00001 Related US Patent 6,323,194
TTDS00001 Related US Patent 6,369,081
TTDS00001 Related US Patent 6,376,675
TTDS00001 Related US Patent 6,423,842
TTDS00001 Related US Patent 6,451,797
TTDS00001 Related US Patent 6,455,552
TTDS00001 Related US Patent 6,458,812
TTDS00001 Related US Patent 6,555,550
TTDS00001 Related US Patent 6,602,891
TTDS00001 Drug(s) Bethanechol DAP000263 Urinary retention Approved
TTDS00001 Drug(s) Trospium DAP000342 Spasm Approved
TTDS00001 Drug(s) Oxyphencyclimine DAP000835 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Tridihexethyl DAP000836 Acquired nystagmus Approved
TTDS00001 Drug(s) Anisotropine Methylbromide DAP000837 Peptic ulcer disease Approved
TTDS00001 Drug(s) Hyoscyamine DAP001108 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Methantheline DAP001109 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Procyclidine DAP001110 Parkinson's disease Approved
TTDS00001 Drug(s) Cyclopentolate DAP001111 Pediatric eye examinations Approved
TTDS00001 Drug(s) Ipratropium DAP001112 Obstructive lung diseases Approved
TTDS00001 Drug(s) Pilocarpine DAP001113 Glaucoma Approved
TTDS00001 Drug(s) Flavoxate DAP001114 Muscle Relaxant Approved
TTDS00001 Drug(s) Mepenzolate DAP001115 Peptic ulcer disease Approved
TTDS00001 Drug(s) Ispaghula DAP001486 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Mebeverine DAP001494 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Trihexyphenidyl HCl DAP001532 Parkinson's Disease Approved
TTDS00001 Antagonist Trospium DAP000342
TTDS00001 Antagonist Hyoscyamine DAP001108
TTDS00001 Antagonist Methantheline DAP001109
TTDS00001 Antagonist Procyclidine DAP001110
TTDS00001 Antagonist Cyclopentolate DAP001111
TTDS00001 Antagonist Ipratropium DAP001112
TTDS00001 Antagonist Flavoxate DAP001114
TTDS00001 Antagonist Mepenzolate DAP001115
TTDS00001 Antagonist Ispaghula DAP001486
TTDS00001 Antagonist Mebeverine DAP001494
TTDS00001 Antagonist Trihexyphenidyl HCl DAP001532
TTDS00001 Agonist Bethanechol DAP000263
TTDS00001 Agonist Pilocarpine DAP001113
TTDS00001 Binder Oxyphencyclimine DAP000835
TTDS00001 Binder Tridihexethyl DAP000836
TTDS00001 Binder Anisotropine Methylbromide DAP000837
TTDS00001 Drug(s) Aclidinium bromide DCL000677 Chronic obstructive pulmonary disease Phase III
TTDS00001 Drug(s) CHF 5407 DCL000750 Chronic obstructive pulmonary disease Phase I
TTDS00001 Drug(s) GSK233705 DCL000823 Chronic obstructive pulmonary disease Phase II completed
TTDS00001 Drug(s) NVA237 DCL000901 Chronic obstructive pulmonary disease Phase III
TTDS00001 Drug(s) Org-23366 DCL000911 Schizophrenia No development reported
TTDS00001 Drug(s) OrM3 DCL000913 Chronic obstructive pulmonary disease Phase IIb
TTDS00001 Antagonist Aclidinium bromide DCL000677
TTDS00001 Antagonist CHF 5407 DCL000750
TTDS00001 Antagonist GSK233705 DCL000823
TTDS00001 Antagonist NVA237 DCL000901
TTDS00001 Antagonist Org-23366 DCL000911
TTDS00001 Antagonist OrM3 DCL000913
TTDS00001 Multitarget Org-23366 DCL000911
TTDS00001 Antagonist Aprophen DNC000245
TTDS00001 Antagonist Benactyzine DNC000293
TTDS00001 Antagonist Hyoscine DNC000757
TTDS00001 Antagonist Hyoscyamine sulfate DNC000758
TTDS00001 Antagonist Ipratropium bromide DNC000806
TTDS00001 Agonist Muscarine DNC000970
TTDS00001 Agonist RS 86 DNC001236
TTDS00001 Target Validation TTDS00001


Then part of expected sample output should contain columns like this

Quote:
Uniprot id Drug Disease Drug Id Approved/Phase Action

P11229 Bethanechol DAP000263 Urinary retention Approved Agonist


And,In the same way names of other drugs and diseases can come underneath it and if any information like disease name or approved/phase is missing for example drugs mentioned in the last that column will remain blank!

Reply With Quote
  #8  
Old December 13th, 2012, 08:53 PM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,460 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 4 Days 6 h 56 m 42 sec
Reputation Power: 403
Why isn't

Pilocarpine DAP001113 Glaucoma Approved

in the output?

Reply With Quote
  #9  
Old December 13th, 2012, 09:03 PM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
Thanks for reply

I just mentioned one drug. sorry but wasnt able to arrange all the drugs and diseases manually

yes
all these drugs and the one you mentioned, even others will also be in output.

Quote:
TTDS00001 Drug(s) Bethanechol DAP000263 Urinary retention Approved
TTDS00001 Drug(s) Trospium DAP000342 Spasm Approved
TTDS00001 Drug(s) Oxyphencyclimine DAP000835 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Tridihexethyl DAP000836 Acquired nystagmus Approved
TTDS00001 Drug(s) Anisotropine Methylbromide DAP000837 Peptic ulcer disease Approved
TTDS00001 Drug(s) Hyoscyamine DAP001108 Gastrointestinal disorders Approved
TTDS00001 Drug(s) Methantheline DAP001109 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Procyclidine DAP001110 Parkinson's disease Approved
TTDS00001 Drug(s) Cyclopentolate DAP001111 Pediatric eye examinations Approved
TTDS00001 Drug(s) Ipratropium DAP001112 Obstructive lung diseases Approved
TTDS00001 Drug(s) Pilocarpine DAP001113 Glaucoma Approved
TTDS00001 Drug(s) Flavoxate DAP001114 Muscle Relaxant Approved
TTDS00001 Drug(s) Mepenzolate DAP001115 Peptic ulcer disease Approved
TTDS00001 Drug(s) Ispaghula DAP001486 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Mebeverine DAP001494 Irritable bowel syndrome Approved
TTDS00001 Drug(s) Trihexyphenidyl HCl DAP001532 Parkinson's Disease Approved


Even those which ar ementioned in the last or in between without disease name in front of it but only Action(Antagonist, Inhibitor) will also come

like these

Quote:
TTDS00001 Antagonist CHF 5407 DCL000750
TTDS00001 Antagonist GSK233705 DCL000823
TTDS00001 Antagonist NVA237 DCL000901
TTDS00001 Antagonist Org-23366 DCL000911
TTDS00001 Antagonist OrM3 DCL000913
TTDS00001 Multitarget Org-23366 DCL000911
TTDS00001 Antagonist Aprophen DNC000245
TTDS00001 Antagonist Benactyzine DNC000293
TTDS00001 Antagonist Hyoscine DNC000757
TTDS00001 Antagonist Hyoscyamine sulfate DNC000758
TTDS00001 Antagonist Ipratropium bromide DNC000806

Reply With Quote
  #10  
Old December 16th, 2012, 07:01 AM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
If any one still have any question abut abo e ques plz let me know as some part of question already solved by perl script but I want to solve by python.

Reply With Quote
  #11  
Old December 16th, 2012, 01:02 PM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,460 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 4 Days 6 h 56 m 42 sec
Reputation Power: 403
Answer rrashkin's crucial question, "If you were a human being reading the input and hand-writing the output, how would you know what to write?" There may be enough information between this thread and the other to solve the puzzle. However, you sadistically torment those whom you ask for help.

You have a solution. Will you pay for someone to rewrite it in python? I'll learn perl for pay.

Do we ignore lines that say "patent"? You haven't said.

What separates the columns? Do columns always end with "words" ending in digits?

Reply With Quote
  #12  
Old December 16th, 2012, 07:38 PM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
Hi Thanks for message

I never thought to torment somebody.

I answered and tried to give expected output as much I understood the questions.

1)Do we ignore lines that say "patent"? You haven't said.

Yes Patent information is not needed.

2)
What separates the columns? Do columns always end with "words" ending in digits?

Columns are separated by tab separator

3)
Do columns always end with "words" ending in digits?
No only last few columns in input file ends with digits because these do not contain disease name and approval/phase in front of it.

Therefore, the sample expected out is like this

Quote:
Uniprot id Drug Drug Id Action Disease Approved/Phase

P11229 Bethanechol DAP000263 Agonist Urinary retention Approved


or even like this

P11229 Ipratropium bromide DNC000806 Antagonist


Int he second out put disease column and approval is blank because it is not mentioned in the input as well.

Reply With Quote
  #13  
Old December 16th, 2012, 07:49 PM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,460 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 4 Days 6 h 56 m 42 sec
Reputation Power: 403
There are no tabs in your original post!
Code:
b	a	c
Fields separated by tabs. A test to see if it's possible.

[edit]I managed to post tabs.[/edit]
[edit2]Indeed, tabs were the first separator I searched for.[/edit2]

Last edited by b49P23TIvg : December 16th, 2012 at 07:51 PM. Reason: test conclusion

Reply With Quote
  #14  
Old December 16th, 2012, 08:29 PM
manigrover manigrover is offline
Contributing User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: May 2012
Posts: 60 manigrover User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 10 h 42 m 3 sec
Reputation Power: 2
Ok

If output columns will be tab separated, that would be good.

Thanks

Reply With Quote
Reply

Viewing: Dev Shed ForumsProgramming LanguagesPython Programming > Fetch specific entries

Developer Shed Advertisers and Affiliates



Thread Tools  Search this Thread 
Search this Thread:

Advanced Search
Display Modes  Rate This Thread 
Rate This Thread:


Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

vB code is On
Smilies are On
[IMG] code is On
HTML code is Off
View Your Warnings | New Posts | Latest News | Latest Threads | Shoutbox
Forum Jump

Forums: » Register « |  User CP |  Games |  Calendar |  Members |  FAQs |  Sitemap |  Support | 
  
 


Powered by: vBulletin Version 3.0.5
Copyright ©2000 - 2013, Jelsoft Enterprises Ltd.

© 2003-2013 by Developer Shed. All rights reserved. DS Cluster - Follow our Sitemap