Python Programming
 
Forums: » Register « |  User CP |  Games |  Calendar |  Members |  FAQs |  Sitemap |  Support | 
User Name:
Password:
Remember me

The Shed is going Social! Join us on FaceBook and Twitter and chime in on the conversation.

Go Back   Dev Shed ForumsProgramming LanguagesPython Programming

Reply
Add This Thread To:
  Del.icio.us   Digg   Google   Spurl   Blink   Furl   Simpy   Y! MyWeb 
Thread Tools Search this Thread Rate Thread Display Modes
 
Unread Dev Shed Forums Sponsor:
  #1  
Old February 5th, 2013, 03:42 AM
utpalmtbi utpalmtbi is offline
Registered User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: Feb 2013
Posts: 12 utpalmtbi User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 4 h 36 m 38 sec
Reputation Power: 0
File header change

Hello all;

I have a multi fasta file (with header[>] and sequence) in the following format:

>contig_1 # 498 # 1826 # 1 # ID=1_1;partial=00;start_type=ATG;rbs_motif=AGxAGG/AGGxGG;rbs_spacer=5-10bp;gc_cont=0.406
MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG
LDPLKTMLVVMSNSENSGGLVLAASPM
>contig_2 # 1823 # 2173 # 1 # ID=1_2;partial=00;start_type=ATG;rbs_motif=GGA/GAG/AGG;rbs_spacer=5-10bp;gc_cont=0.311
MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF
PRPVIGTFRGYVEENKIIIGEDSYSI
....
...

and i want to edit the header lines as just a simple number count:

>1
MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG
LDPLKTMLVVMSNSENSGGLVLAASPM
>2
MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF
PRPVIGTFRGYVEENKIIIGEDSYSI
....
...

may be it's a too simple questions, but I only started to learn python and got stuck..
any idea how to do it?
thanks in advance..

Reply With Quote
  #2  
Old February 5th, 2013, 09:47 AM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,364 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 3 Days 10 h 28 m 48 sec
Reputation Power: 383
I assume you want the number immediately following >contig_
Code:
data = '''>contig_1 # 498 # 1826 # 1 # ID=1_1;partial=00;start_type=ATG;rbs_motif=AGxAGG/AGGxGG;rbs_spacer=5-10bp;gc_cont=0.406
MNLTFDYTKEPSRDVLCIDVKSFYASVECVERG
LDPLKTMLVVMSNSENSGGLVLAASPM
>contig_2 # 1823 # 2173 # 1 # ID=1_2;partial=00;start_type=ATG;rbs_motif=GGA/GAG/AGG;rbs_spacer=5-10bp;gc_cont=0.311
MKQNRKEFSSYFSRSIKQNKPLYLLLMSSETNPF
PRPVIGTFRGYVEENKIIIGEDSYSI
'''

def rewrite(LINE):
    S = '>contig_'
    return (LINE.startswith(S) and ('>' + LINE[len(S):].split()[0])) or LINE

    # traditionally this would be written as

    #if LINE.startswith(S):
    #    return '>' + LINE[len(S):].split()[0]
    #else:
    #    return LINE

for L in data.split('\n'):
    print(rewrite(L))
__________________
[code]Code tags[/code] are essential for python code!

Reply With Quote
  #3  
Old February 5th, 2013, 10:28 AM
utpalmtbi utpalmtbi is offline
Registered User
Dev Shed Newbie (0 - 499 posts)
 
Join Date: Feb 2013
Posts: 12 utpalmtbi User rank is Just a Lowly Private (1 - 20 Reputation Level) 
Time spent in forums: 4 h 36 m 38 sec
Reputation Power: 0
thank u

thank u very much, but I actually want to add after each > simple counter 1, 2... etc..
like :
>1
MNLTFDY
..
>2
MKQNRKE
..
>3
RTV
..

but ur code will do nicely,, thank u..

Reply With Quote
  #4  
Old February 5th, 2013, 10:56 AM
b49P23TIvg's Avatar
b49P23TIvg b49P23TIvg is offline
Contributing User
Dev Shed Loyal (3000 - 3499 posts)
 
Join Date: Aug 2011
Posts: 3,364 b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level)b49P23TIvg User rank is Major (30000 - 40000 Reputation Level) 
Time spent in forums: 1 Month 2 Weeks 3 Days 10 h 28 m 48 sec
Reputation Power: 383
Code:
class count:
    def __init__(self,start = 0):
        self.n = start
    def __call__(self):
        self.n += 1
    def __str__(self):
        return '{}'.format(self.n)

counter = count(1)
print(str(counter))
counter()
print(str(counter))

Reply With Quote
Reply

Viewing: Dev Shed ForumsProgramming LanguagesPython Programming > File header change

Developer Shed Advertisers and Affiliates



Thread Tools  Search this Thread 
Search this Thread:

Advanced Search
Display Modes  Rate This Thread 
Rate This Thread:


Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

vB code is On
Smilies are On
[IMG] code is On
HTML code is Off
View Your Warnings | New Posts | Latest News | Latest Threads | Shoutbox
Forum Jump

Forums: » Register « |  User CP |  Games |  Calendar |  Members |  FAQs |  Sitemap |  Support | 
  
 


Powered by: vBulletin Version 3.0.5
Copyright ©2000 - 2013, Jelsoft Enterprises Ltd.

© 2003-2013 by Developer Shed. All rights reserved. DS Cluster - Follow our Sitemap